Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAB39 Rabbit Polyclonal Antibody (FITC)

CAB39 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MO25, CGI-66

UniProt

Q9Y376

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CAB39

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC35, ID (EMC2, KIAA0103, TTC35, ER Membrane Protein Complex subunit 2, Tetratricopeptide Repeat Domain 35) (MaxLight 490) discontinued
043421-ML490 100 µL

TTC35, ID (EMC2, KIAA0103, TTC35, ER Membrane Protein Complex subunit 2, Tetratricopeptide Repeat Domain 35) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Thyroxine-13C6 4’-O-β-D-Glucuronide Disodium Salt
467604-01 500 µg

Thyroxine-13C6 4’-O-β-D-Glucuronide Disodium Salt

Sign In for Pricing
View Details
Thyroxine-13C6 4’-O-β-D-Glucuronide Disodium Salt
467604-02 1 mg

Thyroxine-13C6 4’-O-β-D-Glucuronide Disodium Salt

Sign In for Pricing
View Details
FYTTD1 Rabbit Polyclonal Antibody (BF488)
orb2526571 100 µL

FYTTD1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Human DERL3 Pre-designed siRNA Set A
SI004213A 1 Each

Human DERL3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
ZNF691 Rabbit Polyclonal Antibody (HRP)
orb2127812 100 µL

ZNF691 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details