Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAB39 Rabbit Polyclonal Antibody (HRP)

CAB39 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MO25, CGI-66

UniProt

Q9Y376

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CAB39

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Rictor Antibody [Alexa Fluor 647]
NB100-611AF647 100 µL

Rabbit Polyclonal Rictor Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Rabbit Anti-Human PSMD5 pAb
PA15269-01 50 μL

Rabbit Anti-Human PSMD5 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human PSMD5 pAb
PA15269-02 100 μL

Rabbit Anti-Human PSMD5 pAb

Sign In for Pricing
View Details
Interleukin 17F (IL-17F) (MaxLight 550) discontinued
I8439-28-ML550 100 µL

Interleukin 17F (IL-17F) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Gnai2 sgRNA CRISPR Lentivector set (Rat)
K7041001 3x 1.0 µg

Gnai2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
DZIP1 Antibody - middle region (ARP77112_P050)
ARP77112_P050 100 µL

DZIP1 Antibody - middle region (ARP77112_P050)

Sign In for Pricing
View Details