Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C15orf15 Rabbit Polyclonal Antibody (Biotin)

C15orf15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L30, RLP24, RPL24, TVAS3, RPL24L, C15orf15, HRP-L30-iso

UniProt

Q9UHA3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C15orf15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD40 Antibody
RD22252F-01 25 µg

Purified Anti-Human CD40 Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD40 Antibody
RD22252F-02 100 µg

Purified Anti-Human CD40 Antibody

Sign In for Pricing
View Details
FOXP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H4]
TA810543AM 100 µL

FOXP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H4]

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1842), CF568 conjugate, 0.1mg/mL
BNC681842-500 1x 500 µL

CD79b (B-Cell Marker) (IGB/1842), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tuberoinfundibular peptide (PTH2) Rabbit Polyclonal Antibody
AP02242SU-N 100 µL

Tuberoinfundibular peptide (PTH2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STING (TMEM173) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C8]
TA505020BM 100 µL

STING (TMEM173) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C8]

Sign In for Pricing
View Details