Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C15orf15 Rabbit Polyclonal Antibody (FITC)

C15orf15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L30, RLP24, RPL24, TVAS3, RPL24L, C15orf15, HRP-L30-iso

UniProt

Q9UHA3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C15orf15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (GYPA/280), Biotin conjugate, 0.1mg/mL
BNCB0280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GTF2H2C activation kit by CRISPRa
GA118928 1 Kit

Human GTF2H2C activation kit by CRISPRa

Sign In for Pricing
View Details
Tph1 Mouse Gene Knockout Kit (CRISPR)
KN518087 1 Kit

Tph1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) -500p
TM67200 500 Reactions

COVID-19 TaqMan RT-PCR Kit (E/RdRP genes) -500p

Sign In for Pricing
View Details
CD28 Mouse Monoclonal Antibody [Clone ID: B-T3]
AM31233PU-N 2 mL (200 Tests)

CD28 Mouse Monoclonal Antibody [Clone ID: B-T3]

Sign In for Pricing
View Details
Human Kruppel Like Factor 15 (KLF15) ELISA Kit
RDR-KLF15-Hu-01 96 Tests

Human Kruppel Like Factor 15 (KLF15) ELISA Kit

Sign In for Pricing
View Details