Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C15orf15 Rabbit Polyclonal Antibody (Biotin)

C15orf15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L30, RLP24, RPL24, TVAS3, RPL24L, C15orf15, HRP-L30-iso

UniProt

Q9UHA3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C15orf15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFE2L2 antibody - C-terminal region
MBS3204254-01 0.1 mL

NFE2L2 antibody - C-terminal region

Sign In for Pricing
View Details
NFE2L2 antibody - C-terminal region
MBS3204254-02 5x 0.1 mL

NFE2L2 antibody - C-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal Proteasome subunit beta type 4 Antibody (OTI2C9) [PE]
NBP2-73655PE 0.1 mL

Mouse Monoclonal Proteasome subunit beta type 4 Antibody (OTI2C9) [PE]

Sign In for Pricing
View Details
Lentiviral mouse Pbk shRNA (UAS) - Lentiviral mouse Pbk shRNA (UAS, iRFP) (100)
GTR15205371 1 Vial

Lentiviral mouse Pbk shRNA (UAS) - Lentiviral mouse Pbk shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
TLL2 Protein Lysate (Human) with C-Ha Tag
46767032 100 µg

TLL2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-200a-3p Vector
mh30304 500 ng

LentimiRa-Off-hsa-miR-200a-3p Vector

Sign In for Pricing
View Details