Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C15orf15 Rabbit Polyclonal Antibody (HRP)

C15orf15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L30, RLP24, RPL24, TVAS3, RPL24L, C15orf15, HRP-L30-iso

UniProt

Q9UHA3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C15orf15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HSP70 Interacting Protein
MBS143869-01 0.01 mg

Recombinant Human HSP70 Interacting Protein

Sign In for Pricing
View Details
Recombinant Human HSP70 Interacting Protein
MBS143869-02 0.05 mg

Recombinant Human HSP70 Interacting Protein

Sign In for Pricing
View Details
Recombinant Human HSP70 Interacting Protein
MBS143869-03 1 mg

Recombinant Human HSP70 Interacting Protein

Sign In for Pricing
View Details
Recombinant Human HSP70 Interacting Protein
MBS143869-04 5x 1 mg

Recombinant Human HSP70 Interacting Protein

Sign In for Pricing
View Details
TRAPPC4 Antibody - middle region : Biotin (ARP56842_P050-Biotin)
ARP56842_P050-Biotin 100 µL

TRAPPC4 Antibody - middle region : Biotin (ARP56842_P050-Biotin)

Sign In for Pricing
View Details
AMHR2 Human shRNA Plasmid Kit (Locus ID 269)
TR320263 1 Kit

AMHR2 Human shRNA Plasmid Kit (Locus ID 269)

Sign In for Pricing
View Details