Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ipo11 Rabbit Polyclonal Antibody (FITC)

Ipo11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ipo11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKNYAYKPSKNFEDSSPETLEAHKIKMAFFTYPTLTEICRRLVSHYFLLT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_226752

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Perfluorohexyl)ethane-1-sulfonic Acid Sodium Salt
TRC-P286310-10MG 10 mg

2-(Perfluorohexyl)ethane-1-sulfonic Acid Sodium Salt

Sign In for Pricing
View Details
HTRA1 (NM_002775) Human Recombinant Protein
TP322362SE 20 µg

HTRA1 (NM_002775) Human Recombinant Protein

Sign In for Pricing
View Details
(S,S)-f-SpiroPhos
TRC-S682940-5MG 5 mg

(S,S)-f-SpiroPhos

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF488A conjugate, 0.1mg/mL
BNC882341-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HNRNPCL2 Human Gene Knockout Kit (CRISPR)
KN427512 1 Kit

HNRNPCL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tcim (NM_026931) Mouse Tagged ORF Clone
MG200377 10 µg

Tcim (NM_026931) Mouse Tagged ORF Clone

Sign In for Pricing
View Details