Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab9b Rabbit Polyclonal Antibody (FITC)

Rab9b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

9330195C02Rik

UniProt

Q8BHH2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_795945

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enpep (Glutamyl Aminopeptidase) BioAssayTM ELISA Kit (Human) discontinued
369879-01 48 Tests

Enpep (Glutamyl Aminopeptidase) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Enpep (Glutamyl Aminopeptidase) BioAssayTM ELISA Kit (Human) discontinued
369879-02 96 Tests

Enpep (Glutamyl Aminopeptidase) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
CNGB3, NT (CNGB3, Cyclic nucleotide-gated cation channel beta-3, Cone photoreceptor cGMP-gated channel subunit beta, Cyclic nucleotide-gated cation channel modulatory subunit, Cyclic nucleotide-gated channel beta-3) (Biotin)
MBS6287165-01 0.2 mL

CNGB3, NT (CNGB3, Cyclic nucleotide-gated cation channel beta-3, Cone photoreceptor cGMP-gated channel subunit beta, Cyclic nucleotide-gated cation channel modulatory subunit, Cyclic nucleotide-gated channel beta-3) (Biotin)

Sign In for Pricing
View Details
CNGB3, NT (CNGB3, Cyclic nucleotide-gated cation channel beta-3, Cone photoreceptor cGMP-gated channel subunit beta, Cyclic nucleotide-gated cation channel modulatory subunit, Cyclic nucleotide-gated channel beta-3) (Biotin)
MBS6287165-02 5x 0.2 mL

CNGB3, NT (CNGB3, Cyclic nucleotide-gated cation channel beta-3, Cone photoreceptor cGMP-gated channel subunit beta, Cyclic nucleotide-gated cation channel modulatory subunit, Cyclic nucleotide-gated channel beta-3) (Biotin)

Sign In for Pricing
View Details
USP12 Blocking Peptide
33R-4187 0.1 mg

USP12 Blocking Peptide

Sign In for Pricing
View Details
Anti-RAD52 Antibody (R3L11)
RHE41301 100 μg

Anti-RAD52 Antibody (R3L11)

Sign In for Pricing
View Details