Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPC111 Rabbit Polyclonal Antibody (FITC)

HSPC111 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HSPC111, HSPC185

UniProt

Q9Y3C1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPC111

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057475

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha Amylase 1/AMY1A Rabbit Polyclonal Antibody (HRP)
orb2578676 100 µg

Alpha Amylase 1/AMY1A Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB)
MBS7008576-01 0.02 mg

Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB)
MBS7008576-02 0.1 mg

Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB)
MBS7008576-03 5x 0.1 mg

Recombinant Aeromonas hydrophila subsp. hydrophila ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
SIM2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2539296 100 µL

SIM2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
AdmiRa-mmu-miR-9-3p Virus
mm2109 250 µL

AdmiRa-mmu-miR-9-3p Virus

Sign In for Pricing
View Details