Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPC111 Rabbit Polyclonal Antibody (HRP)

HSPC111 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSPC111, HSPC185

UniProt

Q9Y3C1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPC111

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057475

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sh3bgr Mouse qPCR Primer Pair (NM_015825)
MP215369 200 Reactions

Sh3bgr Mouse qPCR Primer Pair (NM_015825)

Sign In for Pricing
View Details
FOXS1 Adenovirus (Mouse)
20805054 1.0 mL

FOXS1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Multiplex Assay Kit for Glucocerebrosidase (GBA), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029323 96 Tests

Multiplex Assay Kit for Glucocerebrosidase (GBA), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Research Grade Tralokinumab
HW632036-01 100 µg

Research Grade Tralokinumab

Sign In for Pricing
View Details
Research Grade Tralokinumab
HW632036-02 1 mg

Research Grade Tralokinumab

Sign In for Pricing
View Details
Recombinant Human CMRF35-like molecule 6 (CLM6), partial
orb3009917-01 20 µg

Recombinant Human CMRF35-like molecule 6 (CLM6), partial

Sign In for Pricing
View Details