Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIKESHI Rabbit Polyclonal Antibody (Biotin)

HIKESHI Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L7Rn6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat l7Rn6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RING Finger Protein 121 (RNF121) (FITC)
MBS6149363-01 0.1 mL

RING Finger Protein 121 (RNF121) (FITC)

Sign In for Pricing
View Details
RING Finger Protein 121 (RNF121) (FITC)
MBS6149363-02 5x 0.1 mL

RING Finger Protein 121 (RNF121) (FITC)

Sign In for Pricing
View Details
Mouse Activated Protein C (APC) ELISA Kit
EKN43212 96 Tests

Mouse Activated Protein C (APC) ELISA Kit

Sign In for Pricing
View Details
SUMO1 (Small Ubiquitin-related Modifier 1, DAP-1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, SUMO-1, UBL1) (MaxLight 405)
MBS6439569-01 0.1 mL

SUMO1 (Small Ubiquitin-related Modifier 1, DAP-1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, SUMO-1, UBL1) (MaxLight 405)

Sign In for Pricing
View Details
SUMO1 (Small Ubiquitin-related Modifier 1, DAP-1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, SUMO-1, UBL1) (MaxLight 405)
MBS6439569-02 5x 0.1 mL

SUMO1 (Small Ubiquitin-related Modifier 1, DAP-1, GMP1, OFC10, PIC1, SENP2, SMT3, SMT3C, SMT3H3, SUMO-1, UBL1) (MaxLight 405)

Sign In for Pricing
View Details
IGHVIII-47-1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV764649 1.0 µg DNA

IGHVIII-47-1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details