Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIKESHI Rabbit Polyclonal Antibody (Biotin)

HIKESHI Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L7Rn6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat l7Rn6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSLAQQT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr553 (NM_207621) Mouse Tagged ORF Clone
MR213735 10 µg

Olfr553 (NM_207621) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Monoclonal NME2 Antibody (monoclonal) (M06), Clone: 1D3
APR08746G 0.1mg

Monoclonal NME2 Antibody (monoclonal) (M06), Clone: 1D3

Sign In for Pricing
View Details
Lentiviral mouse Abcb4 shRNA (UAS) - Lentiviral mouse Abcb4 shRNA (UAS, RFP) (25)
GTR15194615 1 Vial

Lentiviral mouse Abcb4 shRNA (UAS) - Lentiviral mouse Abcb4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal Casein Kinase 2 beta Antibody
NBP2-21570 0.1 mL

Rabbit Polyclonal Casein Kinase 2 beta Antibody

Sign In for Pricing
View Details
TMEM91 Blocking Peptide
33R-5873 0.1 mg

TMEM91 Blocking Peptide

Sign In for Pricing
View Details
ERK 2 (D-2) Alexa Fluor® 546
sc-1647 AF546 200 µg/mL

ERK 2 (D-2) Alexa Fluor® 546

Sign In for Pricing
View Details