Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5RAP1 Rabbit Polyclonal Antibody (Biotin)

CDK5RAP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C42, CGI-05, HSPC167, C20orf34

UniProt

Q96SZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDK5RAP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase epsilon 2 (DNA Polymerase epsilon Subunit 2, DNA Polymerase II Subunit 2, DNA Polymerase epsilon Subunit B, POLE2, DPE2, DNA pol ε2, DNA pol εB, DNA pol ε B, DNA polε2, DNApolε2, DNA polεB, DNApolεB) discontinued
222190-01 50 µL

DNA Polymerase epsilon 2 (DNA Polymerase epsilon Subunit 2, DNA Polymerase II Subunit 2, DNA Polymerase epsilon Subunit B, POLE2, DPE2, DNA pol ε2, DNA pol εB, DNA pol ε B, DNA polε2, DNApolε2, DNA polεB, DNApolεB) discontinued

Sign In for Pricing
View Details
DNA Polymerase epsilon 2 (DNA Polymerase epsilon Subunit 2, DNA Polymerase II Subunit 2, DNA Polymerase epsilon Subunit B, POLE2, DPE2, DNA pol ε2, DNA pol εB, DNA pol ε B, DNA polε2, DNApolε2, DNA polεB, DNApolεB) discontinued
222190-02 100 µL

DNA Polymerase epsilon 2 (DNA Polymerase epsilon Subunit 2, DNA Polymerase II Subunit 2, DNA Polymerase epsilon Subunit B, POLE2, DPE2, DNA pol ε2, DNA pol εB, DNA pol ε B, DNA polε2, DNApolε2, DNA polεB, DNApolεB) discontinued

Sign In for Pricing
View Details
TLR2 (Toll-Like Receptor 2) BioAssayTM ELISA Kit (Human) discontinued
384650 96 Tests

TLR2 (Toll-Like Receptor 2) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Anti-OTUB1 Antibody Picoband®, FITC Conjugate
A04361-1-FITC 100 µg/Vial

Anti-OTUB1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Hemin
XH181795-01 10 g

Hemin

Sign In for Pricing
View Details
Hemin
XH181795-02 25 g

Hemin

Sign In for Pricing
View Details