Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdk5rap1 Rabbit Polyclonal Antibody (HRP)

Cdk5rap1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cdk5rap1

UniProt

Q9JLH6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_663773

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFA4L2 Protein Vector (Human) (pPB-N-His)
PV027918 500 ng

NDUFA4L2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Ncf1 Pre-designed siRNA Set B
SI109130B 1 Each

Mouse Ncf1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Kosmotoga olearia Glutamine amidotransferase subunit pdxT (pdxT)
MBS1018517-01 0.02 mg (E-Coli)

Recombinant Kosmotoga olearia Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details
Recombinant Kosmotoga olearia Glutamine amidotransferase subunit pdxT (pdxT)
MBS1018517-02 0.1 mg (E-Coli)

Recombinant Kosmotoga olearia Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details
Recombinant Kosmotoga olearia Glutamine amidotransferase subunit pdxT (pdxT)
MBS1018517-03 0.02 mg (Yeast)

Recombinant Kosmotoga olearia Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details
Recombinant Kosmotoga olearia Glutamine amidotransferase subunit pdxT (pdxT)
MBS1018517-04 0.1 mg (Yeast)

Recombinant Kosmotoga olearia Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details