Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL37 Rabbit Polyclonal Antibody (Biotin)

MRPL37 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L2mt, L37mt, MRPL2, RPML2, MRP-L2, MRP-L37

UniProt

Q9BZE1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL37

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HESP Rabbit pAb
GB115162-100 100 μL

Anti-HESP Rabbit pAb

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1+S2 ECD (S-ECD) (D614G) Protein
RP01293LQ-01 100 μg

Recombinant SARS-CoV-2 Spike S1+S2 ECD (S-ECD) (D614G) Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1+S2 ECD (S-ECD) (D614G) Protein
RP01293LQ-02 500 μg

Recombinant SARS-CoV-2 Spike S1+S2 ECD (S-ECD) (D614G) Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1+S2 ECD (S-ECD) (D614G) Protein
RP01293LQ-03 1000 μg

Recombinant SARS-CoV-2 Spike S1+S2 ECD (S-ECD) (D614G) Protein

Sign In for Pricing
View Details
Interferon regulatory factor 5 IRF5 Rabbit Polyclonal Antibody (APC)
orb2574720 100 µg

Interferon regulatory factor 5 IRF5 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Lentiviral mouse Ly96 shRNA (UAS) - Lentiviral mouse Ly96 shRNA (UAS) plasmid
GTR15266731 1 Vial

Lentiviral mouse Ly96 shRNA (UAS) - Lentiviral mouse Ly96 shRNA (UAS) plasmid

Sign In for Pricing
View Details