Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL37 Rabbit Polyclonal Antibody (HRP)

MRPL37 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L2mt, L37mt, MRPL2, RPML2, MRP-L2, MRP-L37

UniProt

Q9BZE1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL37

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Neurotensin ELISA Kit
MBS024169-01 48 Well

Canine Neurotensin ELISA Kit

Sign In for Pricing
View Details
Canine Neurotensin ELISA Kit
MBS024169-02 96 Well

Canine Neurotensin ELISA Kit

Sign In for Pricing
View Details
Canine Neurotensin ELISA Kit
MBS024169-03 5x 96 Well

Canine Neurotensin ELISA Kit

Sign In for Pricing
View Details
Canine Neurotensin ELISA Kit
MBS024169-04 10x 96 Well

Canine Neurotensin ELISA Kit

Sign In for Pricing
View Details
Lithium carbonate
3123190 1 Each

Lithium carbonate

Sign In for Pricing
View Details
Rabbit Chloride intracellular channel protein 2 (CLIC2) ELISA Kit
MBS7250698-01 48 Well

Rabbit Chloride intracellular channel protein 2 (CLIC2) ELISA Kit

Sign In for Pricing
View Details