Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gng13 Rabbit Polyclonal Antibody (FITC)

Gng13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

G3V8Y0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

7kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001129390

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP Selective Supplement
FD305-5VL 5 VL

CP Selective Supplement

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
MBS2143082-01 0.1 mL

FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
MBS2143082-02 0.2 mL

FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
MBS2143082-03 0.5 mL

FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
MBS2143082-04 1 mL

FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)
MBS2143082-05 5 mL

FITC-Linked Monoclonal Antibody to Tumor Protein p53 (P53)

Sign In for Pricing
View Details