Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IER5 Rabbit Polyclonal Antibody (Biotin)

IER5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SBBI48

UniProt

Q5VY09

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IER5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057629

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4
MBS142984-01 0.005 mg

Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4

Sign In for Pricing
View Details
Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4
MBS142984-02 0.02 mg

Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4

Sign In for Pricing
View Details
Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4
MBS142984-03 1 mg

Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4

Sign In for Pricing
View Details
Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4
MBS142984-04 5x 1 mg

Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4

Sign In for Pricing
View Details
Phospho-Smad2 (Ser465 + Ser467) Rabbit Polyclonal Antibody (AP)
orb900416 100 µL

Phospho-Smad2 (Ser465 + Ser467) Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Olr1736 Protein Vector (Rat) (pPB-N-His)
PV289111 500 ng

Olr1736 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details