Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Shc3 Rabbit Polyclonal Antibody (FITC)

Shc3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

N-S, Rai, Shc, ShcC, N-Shc

UniProt

Q61120

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TULP2, ID (TULP2, TUBL2, Tubby-related protein 2, Cancer/testis antigen 65, Tubby-like protein 2) (MaxLight 650)
MBS6360296-01 0.1 mL

TULP2, ID (TULP2, TUBL2, Tubby-related protein 2, Cancer/testis antigen 65, Tubby-like protein 2) (MaxLight 650)

Sign In for Pricing
View Details
TULP2, ID (TULP2, TUBL2, Tubby-related protein 2, Cancer/testis antigen 65, Tubby-like protein 2) (MaxLight 650)
MBS6360296-02 5x 0.1 mL

TULP2, ID (TULP2, TUBL2, Tubby-related protein 2, Cancer/testis antigen 65, Tubby-like protein 2) (MaxLight 650)

Sign In for Pricing
View Details
Vmn1r82 (NM_134234) Mouse Tagged Lenti ORF Clone
MR223552L3 10 µg

Vmn1r82 (NM_134234) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human MANEA Knockout A549 cell line
GTR15405408 1 Vial

Human MANEA Knockout A549 cell line

Sign In for Pricing
View Details
Akt1 (v-akt Murine Thymoma Viral Oncogene Homolog 1, C-AKT, MGC99656, Oncogene AKT1, PRKBA, Protein Kinase B, PKB, RAC, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha) (MaxLight 490) discontinued
A1125-13F-ML490 100 µL

Akt1 (v-akt Murine Thymoma Viral Oncogene Homolog 1, C-AKT, MGC99656, Oncogene AKT1, PRKBA, Protein Kinase B, PKB, RAC, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha) (MaxLight 490) discontinued

Sign In for Pricing
View Details
TNFRSF14 Antibody (C-term)
orb1926376-01 50 µL

TNFRSF14 Antibody (C-term)

Sign In for Pricing
View Details