Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Shc3 Rabbit Polyclonal Antibody (HRP)

Shc3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N-S, Rai, Shc, ShcC, N-Shc

UniProt

Q61120

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribosomal Protein L8 (60S Ribosomal Protein L8, L8, RPL8) (PE)
138290-PE 100 µL

Ribosomal Protein L8 (60S Ribosomal Protein L8, L8, RPL8) (PE)

Sign In for Pricing
View Details
IRF3 (10R8) Rabbit Monoclonal Antibody
E28M7257 100 µL

IRF3 (10R8) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-SWAP Antibody
MBS4506375-01 0.05 mL

Rabbit anti-SWAP Antibody

Sign In for Pricing
View Details
Rabbit anti-SWAP Antibody
MBS4506375-02 0.1 mL

Rabbit anti-SWAP Antibody

Sign In for Pricing
View Details
Rabbit anti-SWAP Antibody
MBS4506375-03 5x 0.1 mL

Rabbit anti-SWAP Antibody

Sign In for Pricing
View Details
Recombinant Human Fibronectin type III domain-containing protein 9 (FNDC9)
MBS7014965-01 0.02 mg

Recombinant Human Fibronectin type III domain-containing protein 9 (FNDC9)

Sign In for Pricing
View Details