Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL5IP Rabbit Polyclonal Antibody (HRP)

UCHL5IP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UIP1, UCHL5IP

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UCHL5IP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_996990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWP2 (NM_007014) Human Recombinant Protein
PROTO00308 20 µg

WWP2 (NM_007014) Human Recombinant Protein

Sign In for Pricing
View Details
C20orf79 Polyclonal Antibody, PE-Cy7 Conjugated
bs-15118R-PE-Cy7 100 µL

C20orf79 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
PVRL4 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
38223154 3x 1.0 µg DNA

PVRL4 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
PLA2G4B (Cytosolic Phospholipase A2 beta, cPLA2-beta, Phospholipase A2 Group IVB) (AP)
MBS6389669-01 0.1 mL

PLA2G4B (Cytosolic Phospholipase A2 beta, cPLA2-beta, Phospholipase A2 Group IVB) (AP)

Sign In for Pricing
View Details
PLA2G4B (Cytosolic Phospholipase A2 beta, cPLA2-beta, Phospholipase A2 Group IVB) (AP)
MBS6389669-02 5x 0.1 mL

PLA2G4B (Cytosolic Phospholipase A2 beta, cPLA2-beta, Phospholipase A2 Group IVB) (AP)

Sign In for Pricing
View Details
Mouse Vascular Endothelial Growth Factor D (VEGFD) ELISA Kit
EKN49212 96 Tests

Mouse Vascular Endothelial Growth Factor D (VEGFD) ELISA Kit

Sign In for Pricing
View Details