Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf29 Rabbit Polyclonal Antibody (Biotin)

C2orf29 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C40, C2orf29

UniProt

Q9UKZ1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C2orf29

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_060016

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)
SIPB941Hu02-01 10 µg

Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)

Sign In for Pricing
View Details
Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)
SIPB941Hu02-02 50 µg

Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)

Sign In for Pricing
View Details
Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)
SIPB941Hu02-03 200 µg

Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)

Sign In for Pricing
View Details
Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)
SIPB941Hu02-04 1 mg

Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)

Sign In for Pricing
View Details
Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)
SIPB941Hu02-05 5 mg

Recombinant Sialic Acid Binding Ig Like Lectin 12 (SIGLEC12)

Sign In for Pricing
View Details
Hsa-miR-6510-3p miRNA Inhibitor
orb1871501-01 10 nmol

Hsa-miR-6510-3p miRNA Inhibitor

Sign In for Pricing
View Details