Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf29 Rabbit Polyclonal Antibody (FITC)

C2orf29 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C40, C2orf29

UniProt

Q9UKZ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C2orf29

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060016

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamic Pyruvic Transaminase, NT (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (MaxLight 405)
MBS6478203-01 0.1 mL

Glutamic Pyruvic Transaminase, NT (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (MaxLight 405)

Sign In for Pricing
View Details
Glutamic Pyruvic Transaminase, NT (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (MaxLight 405)
MBS6478203-02 5x 0.1 mL

Glutamic Pyruvic Transaminase, NT (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Polyclonal Swine Influenza A H1N1 Nucleocapsid Antibody [DyLight 755]
NBP2-41072IR 0.1 mL

Rabbit Polyclonal Swine Influenza A H1N1 Nucleocapsid Antibody [DyLight 755]

Sign In for Pricing
View Details
Anti-STAT4 Antibody Picoband® (Biotine Conjugate)
PA1692-Biotin 100 µg/Vial

Anti-STAT4 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
C7orf61-set siRNA/shRNA/RNAi Lentivector (Human)
14701091 4x 500 ng

C7orf61-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Compound STOCK1N-51124
T127102-01 10 mg

Compound STOCK1N-51124

Sign In for Pricing
View Details