Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIER2 Rabbit Polyclonal Antibody (HRP)

MIER2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mi-er2, KIAA1193

UniProt

Q8N344

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MIER2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060020

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

2010001M09Rik Protein Vector (Mouse) (pPM-C-HA)
PV147648 500 ng

2010001M09Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SNORD111 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2237007 1.0 µg DNA

SNORD111 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
APOC1 Antibody
E19-10148-1 50 µg - 50 µL

APOC1 Antibody

Sign In for Pricing
View Details
Mouse Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) ELISA Kit
RK13251 96 Tests

Mouse Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) ELISA Kit

Sign In for Pricing
View Details
Mouse Cystm1 Pre-designed siRNA Set B
SI103347B 1 Each

Mouse Cystm1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal B7-1/CD80 Antibody (C80/1608) [DyLight 755]
NBP2-54307IR 100 µL

Mouse Monoclonal B7-1/CD80 Antibody (C80/1608) [DyLight 755]

Sign In for Pricing
View Details