Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIER2 Rabbit Polyclonal Antibody (Biotin)

MIER2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mi-er2, KIAA1193

UniProt

Q8N344

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MIER2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060020

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-butyl N-[ (3-aminocyclopentyl) methyl]carbamate, Mixture of diastereomers
SFC80445-01 50 mg

Tert-butyl N-[ (3-aminocyclopentyl) methyl]carbamate, Mixture of diastereomers

Sign In for Pricing
View Details
Tert-butyl N-[ (3-aminocyclopentyl) methyl]carbamate, Mixture of diastereomers
SFC80445-02 0.5 g

Tert-butyl N-[ (3-aminocyclopentyl) methyl]carbamate, Mixture of diastereomers

Sign In for Pricing
View Details
TMS1 Rabbit mAb Antibody
orb1951542-01 50 µL

TMS1 Rabbit mAb Antibody

Sign In for Pricing
View Details
TMS1 Rabbit mAb Antibody
orb1951542-02 100 µL

TMS1 Rabbit mAb Antibody

Sign In for Pricing
View Details
Interleukin 33 (IL33, Interleukin-33, IL-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor from High Endothelial Venules, NF-HEV, C9orf26, IL1F11, NFHEV) (MaxLight 550) discontinued
143624-ML550 100 µL

Interleukin 33 (IL33, Interleukin-33, IL-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor from High Endothelial Venules, NF-HEV, C9orf26, IL1F11, NFHEV) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Eukaryotic translation initiation Factor 3a (EIF3a) Rabbit ELISA Kit
D1263 96 Tests

Eukaryotic translation initiation Factor 3a (EIF3a) Rabbit ELISA Kit

Sign In for Pricing
View Details