Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIER2 Rabbit Polyclonal Antibody (HRP)

MIER2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mi-er2, KIAA1193

UniProt

Q8N344

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MIER2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060020

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASXL2 Protein Vector (Mouse) (pPB-C-His)
PV156874 500 ng

ASXL2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Anti-FAM29A/HAUS6 Antibody Picoband® Fluoro488 Conjugated
A10580-1-Fluoro488 100 µg/Vial

Anti-FAM29A/HAUS6 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Porcine Synuclein, Alpha ELISA Kit
MBS737964-01 48 Well

Porcine Synuclein, Alpha ELISA Kit

Sign In for Pricing
View Details
Porcine Synuclein, Alpha ELISA Kit
MBS737964-02 96 Well

Porcine Synuclein, Alpha ELISA Kit

Sign In for Pricing
View Details
Porcine Synuclein, Alpha ELISA Kit
MBS737964-03 5x 96 Well

Porcine Synuclein, Alpha ELISA Kit

Sign In for Pricing
View Details
Porcine Synuclein, Alpha ELISA Kit
MBS737964-04 10x 96 Well

Porcine Synuclein, Alpha ELISA Kit

Sign In for Pricing
View Details