Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR55 Rabbit Polyclonal Antibody (HRP)

WDR55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ20195, FLJ21702

UniProt

Q9H6Y2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WDR55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060176

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GFPT2 sgRNA gene knockout kit - Lentiviral human GFPT2 sgRNA gene knockout kit (plasmid)
GTR15383180 1 Vial

Lentiviral human GFPT2 sgRNA gene knockout kit - Lentiviral human GFPT2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ABCE1 Protein Vector (Rat) (pPB-C-His)
PV251466 500 ng

ABCE1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
SPATA24 Adenovirus (Human)
45224051 1.0 mL

SPATA24 Adenovirus (Human)

Sign In for Pricing
View Details
HOMER2P2 Protein Vector (Human) (pPB-C-His)
PV084333 500 ng

HOMER2P2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Duck alpha-Thromboglobulin ELISA Kit
MBS087221 Inquire

Duck alpha-Thromboglobulin ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/8280R) [DyLight 680]
NBP3-23986FR 0.1 mL

Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/8280R) [DyLight 680]

Sign In for Pricing
View Details