Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TASP1 Rabbit Polyclonal Antibody (FITC)

TASP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SULEHS, C20orf13, dJ585I14.2

UniProt

Q9H6P5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TASP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060184

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protease, Serine 50 (TSP50) Antibody
abx239051 100 µg

Protease, Serine 50 (TSP50) Antibody

Sign In for Pricing
View Details
Coronin 3 (CORO1C) (NM_014325) Human Tagged Lenti ORF Clone
RC201802L2 10 µg

Coronin 3 (CORO1C) (NM_014325) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KNTC1 Protein Vector (Mouse) (pPM-C-HA)
PV195120 500 ng

KNTC1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NBL1, 18-181aa, Human, His tag, E.coli
E53A03101 50 µg

NBL1, 18-181aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Rabbit Polyclonal XK X-linked Kx blood group Antibody [Janelia Fluor 646]
NBP3-05963JF646 0.1 mL

Rabbit Polyclonal XK X-linked Kx blood group Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Recombinant Allergenic Isoflavone Reductase-Like Protein Bet v 6.0102
MBS141202-01 0.05 mg

Recombinant Allergenic Isoflavone Reductase-Like Protein Bet v 6.0102

Sign In for Pricing
View Details