Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TASP1 Rabbit Polyclonal Antibody (HRP)

TASP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SULEHS, C20orf13, dJ585I14.2

UniProt

Q9H6P5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TASP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060184

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Siglec 8, NT (Siglec 8, SAF2, Sialic acid-binding Ig-like lectin 8, CDw329, Sialoadhesin family member 2, CD329) (APC)
MBS6347627-01 0.2 mL

Siglec 8, NT (Siglec 8, SAF2, Sialic acid-binding Ig-like lectin 8, CDw329, Sialoadhesin family member 2, CD329) (APC)

Sign In for Pricing
View Details
Siglec 8, NT (Siglec 8, SAF2, Sialic acid-binding Ig-like lectin 8, CDw329, Sialoadhesin family member 2, CD329) (APC)
MBS6347627-02 5x 0.2 mL

Siglec 8, NT (Siglec 8, SAF2, Sialic acid-binding Ig-like lectin 8, CDw329, Sialoadhesin family member 2, CD329) (APC)

Sign In for Pricing
View Details
Pyruvate Kinase Antibody Biotin Conjugated
orb344385 25 µL

Pyruvate Kinase Antibody Biotin Conjugated

Sign In for Pricing
View Details
OR6R1P CRISPR All-in-one AAV vector set (with saCas9)(Human)
35527151 3x 1.0 µg DNA

OR6R1P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Olfr1386 Protein Lysate (Mouse) with C-HA Tag
32831034 100 µg

Olfr1386 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PLEKHO2 (NM_025201) Human Mass Spec Standard
PH323676 10 µg

PLEKHO2 (NM_025201) Human Mass Spec Standard

Sign In for Pricing
View Details