Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC27 Rabbit Polyclonal Antibody (HRP)

TTC27 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ20272

UniProt

Q6P3X3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TTC27

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDQLDIAKDISQLQIDLTGALGKRTRFQENYVAQLILDVRREGDVLSNCE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060205

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MBNL2 sgRNA gene knockout kit - Lentiviral human MBNL2 sgRNA gene knockout kit (25)
GTR15374610 1 Vial

Lentiviral human MBNL2 sgRNA gene knockout kit - Lentiviral human MBNL2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
TPBG, Fc Fusion (lgG), Avi-Tag Recombinant
101516-1 25 µg

TPBG, Fc Fusion (lgG), Avi-Tag Recombinant

Sign In for Pricing
View Details
Fhl3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4460505 3x 1.0 µg

Fhl3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
LHFPL5 Rabbit pAb, PE-Cy5.5 conjugated
orb2874502 100 µL

LHFPL5 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
ZDHHC19 AAV Vector (Human) (CMV)
50788101 1 µg

ZDHHC19 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
IGFALS Recombinant Protein Antigen
NBP1-89117PEP 0.1 mL

IGFALS Recombinant Protein Antigen

Sign In for Pricing
View Details