Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNRC2 Rabbit Polyclonal Antibody (Biotin)

PNRC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ20312, MGC99541

UniProt

Q9NPJ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PNRC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB35, CT (Ras-related Protein Rab-35, GTP-binding Protein RAY, Ras-related Protein Rab-1C, RAB1C, RAY) (AP)
MBS6270078-01 0.1 mL

RAB35, CT (Ras-related Protein Rab-35, GTP-binding Protein RAY, Ras-related Protein Rab-1C, RAB1C, RAY) (AP)

Sign In for Pricing
View Details
RAB35, CT (Ras-related Protein Rab-35, GTP-binding Protein RAY, Ras-related Protein Rab-1C, RAB1C, RAY) (AP)
MBS6270078-02 5x 0.1 mL

RAB35, CT (Ras-related Protein Rab-35, GTP-binding Protein RAY, Ras-related Protein Rab-1C, RAB1C, RAY) (AP)

Sign In for Pricing
View Details
Recombinant Human LHPP Protein, N-His-SUMO
HP444022-01 50 µg

Recombinant Human LHPP Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human LHPP Protein, N-His-SUMO
HP444022-02 100 µg

Recombinant Human LHPP Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human LHPP Protein, N-His-SUMO
HP444022-03 1 mg

Recombinant Human LHPP Protein, N-His-SUMO

Sign In for Pricing
View Details
Antileishmanial agent-3
T61391-01 25 mg

Antileishmanial agent-3

Sign In for Pricing
View Details