Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNRC2 Rabbit Polyclonal Antibody (HRP)

PNRC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ20312, MGC99541

UniProt

Q9NPJ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PNRC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal V5 Epitope Tag Antibody (SV5-P-K) [Biotin]
NBP2-81037B 0.1 mL

Rat Monoclonal V5 Epitope Tag Antibody (SV5-P-K) [Biotin]

Sign In for Pricing
View Details
LEPROTL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1208808 1.0 µg DNA

LEPROTL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal Respiratory Syncytial Virus Nucleoprotein Antibody (1C3) [DyLight 755]
NBP2-50534IR 0.1 mL

Mouse Monoclonal Respiratory Syncytial Virus Nucleoprotein Antibody (1C3) [DyLight 755]

Sign In for Pricing
View Details
Mouse Immunoglobulin J Chain / IGJ (JCHAIN) ELISA Kit
abx513597 96 Tests

Mouse Immunoglobulin J Chain / IGJ (JCHAIN) ELISA Kit

Sign In for Pricing
View Details
Anti-Sprouty 3 Antibody
MBS8308242-01 0.03 mL

Anti-Sprouty 3 Antibody

Sign In for Pricing
View Details
Anti-Sprouty 3 Antibody
MBS8308242-02 0.05 mL

Anti-Sprouty 3 Antibody

Sign In for Pricing
View Details