Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YTHDF1 Rabbit Polyclonal Antibody (HRP)

YTHDF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DF1, C20orf21

UniProt

Q9BYJ9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human YTHDF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_060268

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn1r44 shRNA (UAS) - Lentiviral mouse Vmn1r44 shRNA (UAS, iRFP) (100)
GTR15131547 1 Vial

Lentiviral mouse Vmn1r44 shRNA (UAS) - Lentiviral mouse Vmn1r44 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rat Vasopeptidase inhibitors ELISA Kit
MBS726661-01 48 Well

Rat Vasopeptidase inhibitors ELISA Kit

Sign In for Pricing
View Details
Rat Vasopeptidase inhibitors ELISA Kit
MBS726661-02 96 Well

Rat Vasopeptidase inhibitors ELISA Kit

Sign In for Pricing
View Details
Rat Vasopeptidase inhibitors ELISA Kit
MBS726661-03 5x 96 Well

Rat Vasopeptidase inhibitors ELISA Kit

Sign In for Pricing
View Details
Rat Vasopeptidase inhibitors ELISA Kit
MBS726661-04 10x 96 Well

Rat Vasopeptidase inhibitors ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Human PMEL17/ME20M Antibody (17A9), PE
ARO-A20282 100 µg

Mouse Anti-Human PMEL17/ME20M Antibody (17A9), PE

Sign In for Pricing
View Details