Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD3 Rabbit Polyclonal Antibody (Biotin)

CHCHD3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mic19, MINOS3, MICOS19, PPP1R22

UniProt

Q9NX63

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_060282

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neopentyl glycol diglycidyl ether
GX9266-25ml 25 mL

Neopentyl glycol diglycidyl ether

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Aspartate--tRNA ligase (aspS), partial
MBS1262360 Inquire

Recombinant Clostridium botulinum Aspartate--tRNA ligase (aspS), partial

Sign In for Pricing
View Details
Kylt® FimA, FimH, F41
31718 100 Reactions

Kylt® FimA, FimH, F41

Sign In for Pricing
View Details
Human Beta-casein ELISA Kit
EK3316 Inquire

Human Beta-casein ELISA Kit

Sign In for Pricing
View Details
Mycobacterium tuberculosis antigen 14/16 Chimeric Protein, Recombinant
048853 100 µg

Mycobacterium tuberculosis antigen 14/16 Chimeric Protein, Recombinant

Sign In for Pricing
View Details
Lentiviral human PALB2 sgRNA gene knockout kit - Lentiviral human PALB2 sgRNA gene knockout kit (25)
GTR15384234 1 Vial

Lentiviral human PALB2 sgRNA gene knockout kit - Lentiviral human PALB2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details