Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD3 Rabbit Polyclonal Antibody (FITC)

CHCHD3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mic19, MINOS3, MICOS19, PPP1R22

UniProt

Q9NX63

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHCHD3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_060282

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lsm7 ORF Vector (Rat) (pORF)
ORF070073 1.0 µg DNA

Lsm7 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
HSPB11 (Heat Shock Protein beta-11, Placental Protein 25, PP25, IFT25, C1orf41, HSPCO34) (Biotin)
MBS6421746-01 0.1 mL

HSPB11 (Heat Shock Protein beta-11, Placental Protein 25, PP25, IFT25, C1orf41, HSPCO34) (Biotin)

Sign In for Pricing
View Details
HSPB11 (Heat Shock Protein beta-11, Placental Protein 25, PP25, IFT25, C1orf41, HSPCO34) (Biotin)
MBS6421746-02 5x 0.1 mL

HSPB11 (Heat Shock Protein beta-11, Placental Protein 25, PP25, IFT25, C1orf41, HSPCO34) (Biotin)

Sign In for Pricing
View Details
Colony Stimulating Factor 2 Receptor Alpha (CSF2RA) Antibody
abx031052-01 80 µL

Colony Stimulating Factor 2 Receptor Alpha (CSF2RA) Antibody

Sign In for Pricing
View Details
Colony Stimulating Factor 2 Receptor Alpha (CSF2RA) Antibody
abx031052-02 400 µL

Colony Stimulating Factor 2 Receptor Alpha (CSF2RA) Antibody

Sign In for Pricing
View Details
Rat Monoclonal Fc gamma RIII (CD16) Antibody (275003) [PE/Cy7]
FAB19601PECY7 0.1 mL

Rat Monoclonal Fc gamma RIII (CD16) Antibody (275003) [PE/Cy7]

Sign In for Pricing
View Details