Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf95 Rabbit Polyclonal Antibody (HRP)

C9orf95 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NRK1, C9orf95, bA235O14.2

UniProt

Q9NWW6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf95

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060351

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zscan2 shRNA (UAS) - Lentiviral mouse Zscan2 shRNA (UAS, RFP) plasmid
GTR15166813 1 Vial

Lentiviral mouse Zscan2 shRNA (UAS) - Lentiviral mouse Zscan2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)
MBS3030074-01 5 mg

Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)

Sign In for Pricing
View Details
Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)
MBS3030074-02 25 mg

Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)

Sign In for Pricing
View Details
Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)
MBS3030074-03 50 mg

Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)

Sign In for Pricing
View Details
Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)
MBS3030074-04 100 mg

Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)

Sign In for Pricing
View Details
Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)
MBS3030074-05 5x 100 mg

Anti-Mouse CD90 In Vivo Antibody - Low Endotoxin (HK2.1)

Sign In for Pricing
View Details