Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PINX1 Rabbit Polyclonal Antibody (HRP)

PINX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gno1, LPTL, LPTS, Pxr1

UniProt

Q96BK5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PINX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bmp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
13367116 3x 1.0 µg

Bmp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Fbxo5 (NM_025995) Mouse Tagged Lenti ORF Clone
MR206701L4 10 µg

Fbxo5 (NM_025995) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SYN1 (Synapsin I, SYN1a, SYN1b, SYNI) (PE)
MBS6185363-01 0.1 mL

SYN1 (Synapsin I, SYN1a, SYN1b, SYNI) (PE)

Sign In for Pricing
View Details
SYN1 (Synapsin I, SYN1a, SYN1b, SYNI) (PE)
MBS6185363-02 5x 0.1 mL

SYN1 (Synapsin I, SYN1a, SYN1b, SYNI) (PE)

Sign In for Pricing
View Details
BAX peptide
orb234672-01 1 mg

BAX peptide

Sign In for Pricing
View Details
BAX peptide
orb234672-02 5 mg

BAX peptide

Sign In for Pricing
View Details