Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PINX1 Rabbit Polyclonal Antibody (FITC)

PINX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gno1, LPTL, LPTS, Pxr1

UniProt

Q96BK5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PINX1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060354

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd8a Mouse Monoclonal Antibody [Clone ID: AD4(15)]
CL010P 250 µg

Cd8a Mouse Monoclonal Antibody [Clone ID: AD4(15)]

Sign In for Pricing
View Details
ZNF25 Human Gene Knockout Kit (CRISPR)
KN422964 1 Kit

ZNF25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EXTRAClean Cell Culture Media Exosome Purification and RNA Isolation Maxi Kit
73320 15 Preparations

EXTRAClean Cell Culture Media Exosome Purification and RNA Isolation Maxi Kit

Sign In for Pricing
View Details
Human TMEM26 activation kit by CRISPRa
GA116505 1 Kit

Human TMEM26 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707715 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
TSEN34 Mouse Monoclonal Antibody [Clone ID: OTI6B3]
CF810146 100 µg

TSEN34 Mouse Monoclonal Antibody [Clone ID: OTI6B3]

Sign In for Pricing
View Details