Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ppp2r3c Rabbit Polyclonal Antibody (Biotin)

Ppp2r3c Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1309207

UniProt

Q6AXZ3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014218

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCLKC (Cadherin-related Family Member 2, Protocadherin LKC, PC-LKC, Protocadherin-24, PCDH24, PCLKC, FLJ20124, FLJ20383, MGC163154)
MBS6011953-01 0.1 mg

PCLKC (Cadherin-related Family Member 2, Protocadherin LKC, PC-LKC, Protocadherin-24, PCDH24, PCLKC, FLJ20124, FLJ20383, MGC163154)

Sign In for Pricing
View Details
PCLKC (Cadherin-related Family Member 2, Protocadherin LKC, PC-LKC, Protocadherin-24, PCDH24, PCLKC, FLJ20124, FLJ20383, MGC163154)
MBS6011953-02 5x 0.1 mg

PCLKC (Cadherin-related Family Member 2, Protocadherin LKC, PC-LKC, Protocadherin-24, PCDH24, PCLKC, FLJ20124, FLJ20383, MGC163154)

Sign In for Pricing
View Details
ATG7 autophagy related 7 homolog (S. cerevisiae)
307138 100 µL

ATG7 autophagy related 7 homolog (S. cerevisiae)

Sign In for Pricing
View Details
Human IL18R1 / CD218a ELISA Kit
NS-E10091-01 1 Each

Human IL18R1 / CD218a ELISA Kit

Sign In for Pricing
View Details
Human IL18R1 / CD218a ELISA Kit
NS-E10091-02 1 Each

Human IL18R1 / CD218a ELISA Kit

Sign In for Pricing
View Details
Tert-Butyl 4-carbamoylbenzylcarbamate
OR1072171-01 100 mg

Tert-Butyl 4-carbamoylbenzylcarbamate

Sign In for Pricing
View Details