Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf119 Rabbit Polyclonal Antibody (FITC)

C14orf119 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C14orf119

UniProt

Q9NWQ9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human C14orf119

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_060394

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF1C (NM_005679) Human 3' UTR Clone
SC212336 10 µg

TAF1C (NM_005679) Human 3' UTR Clone

Sign In for Pricing
View Details
Amy1a sgRNA CRISPR Lentivector (Rat) (Target 3)
K6656604 1.0 µg DNA

Amy1a sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-associated Epithelial Membrane Antigen, EMA, Tumor-associated Mucin, CD227, PUM)
138146 1 mg

MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-associated Epithelial Membrane Antigen, EMA, Tumor-associated Mucin, CD227, PUM)

Sign In for Pricing
View Details
FAM198B shRNA (m) Lentiviral Particles
sc-108174-V 200 µL

FAM198B shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Bacillus subtilis UPF0053 protein yqhB (yqhB)
MBS1013525 Inquire

Recombinant Bacillus subtilis UPF0053 protein yqhB (yqhB)

Sign In for Pricing
View Details
Tmed10 (NM_053467) Rat Tagged ORF Clone Lentiviral Particle
RR213216L4V 200 µL

Tmed10 (NM_053467) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details