Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPATCH2 Rabbit Polyclonal Antibody (HRP)

GPATCH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pfa1, CT110, GPATC2, PPP1R30

UniProt

Q9NW75

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of mouse GPATCH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSYNVHHPWETGHCLSEGSDSSLEEPSKDYREKHSNNKKDRSDSDDQMLV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001284683.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N, N-dipentyl-7- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzo[c][1,2,5]thiadiazol-4-amine
JH919196 1 Each

N, N-dipentyl-7- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzo[c][1,2,5]thiadiazol-4-amine

Sign In for Pricing
View Details
RELA, Phosphorylated (pS536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 750)
MBS6341288-01 0.1 mL

RELA, Phosphorylated (pS536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 750)

Sign In for Pricing
View Details
RELA, Phosphorylated (pS536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 750)
MBS6341288-02 5x 0.1 mL

RELA, Phosphorylated (pS536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 750)

Sign In for Pricing
View Details
Vitamin D Receptor (VDR, vitamin D (1,25- dihydroxyvitamin D3) receptor , HGNC:12679, NR1I1, vitamin D (1,25-dihydroxyvitamin D3) receptor)
V2130-01B 50 µg

Vitamin D Receptor (VDR, vitamin D (1,25- dihydroxyvitamin D3) receptor , HGNC:12679, NR1I1, vitamin D (1,25-dihydroxyvitamin D3) receptor)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Glucagon (GCG)
MBS2121388-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Glucagon (GCG)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Glucagon (GCG)
MBS2121388-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Glucagon (GCG)

Sign In for Pricing
View Details