Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGGF1 Rabbit Polyclonal Antibody (Biotin)

AGGF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

VG5Q, GPATC7, GPATCH7, HSU84971, HUS84971

UniProt

Q8N302

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AGGF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Medag Pre-designed siRNA Set A
SI108332A 1 Each

Mouse Medag Pre-designed siRNA Set A

Sign In for Pricing
View Details
Syntaxin 7 (STX7) Human qPCR Primer Pair (NM_003569)
HP207068 200 Reactions

Syntaxin 7 (STX7) Human qPCR Primer Pair (NM_003569)

Sign In for Pricing
View Details
Pcdha10 Mouse shRNA Plasmid (Locus ID 12943)
TL500431 1 Kit

Pcdha10 Mouse shRNA Plasmid (Locus ID 12943)

Sign In for Pricing
View Details
Sterol Carrier Protein 2
550028 200 µL

Sterol Carrier Protein 2

Sign In for Pricing
View Details
Syndecan 4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-2926R-BF750-TR 20 µL

Syndecan 4 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
pCR4-TOPO-GIN1 Plasmid
PVT30719 2 µg

pCR4-TOPO-GIN1 Plasmid

Sign In for Pricing
View Details