Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGGF1 Rabbit Polyclonal Antibody (HRP)

AGGF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VG5Q, GPATC7, GPATCH7, HSU84971, HUS84971

UniProt

Q8N302

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AGGF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM8/CD66b, Recombinant, Human, His-Tag discontinued
047332-01 10 µg

CEACAM8/CD66b, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
CEACAM8/CD66b, Recombinant, Human, His-Tag discontinued
047332-02 50 µg

CEACAM8/CD66b, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
Human SEC13 Knockout A549 cell line
GTR15418883 1 Vial

Human SEC13 Knockout A549 cell line

Sign In for Pricing
View Details
Rabbit Polyclonal VEGF Antibody [Alexa Fluor 647]
NB100-2381AF647 0.1 mL

Rabbit Polyclonal VEGF Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Guinea Pig F box only protein 42 (FBXO42) ELISA kit
GTR10398796 96 Well

Guinea Pig F box only protein 42 (FBXO42) ELISA kit

Sign In for Pricing
View Details
(E)-3-(5-Nitrofuran-2-yl)acrylaldehyde
TRC-N495950-100MG 100 mg

(E)-3-(5-Nitrofuran-2-yl)acrylaldehyde

Sign In for Pricing
View Details