Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NODAL Rabbit Polyclonal Antibody (HRP)

NODAL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HTX5

UniProt

Q96S42

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NODAL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060525

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem119 (NM_146162) Mouse Tagged ORF Clone
MG203782 10 µg

Tmem119 (NM_146162) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-BRAF35 Antibody
bs-70855R 100 µL

Anti-BRAF35 Antibody

Sign In for Pricing
View Details
Lentiviral human RNASE8 sgRNA gene knockout kit - Lentiviral human RNASE8 sgRNA gene knockout kit (100)
GTR15399154 1 Vial

Lentiviral human RNASE8 sgRNA gene knockout kit - Lentiviral human RNASE8 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
COL14A1 Antibody
OACD02621-1ML 1 mL

COL14A1 Antibody

Sign In for Pricing
View Details
MMP21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1312407 1.0 µg DNA

MMP21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human Filamin B Beta (FLNb) ELISA Kit
DLR-FLNb-Hu-48T 48 Tests

Human Filamin B Beta (FLNb) ELISA Kit

Sign In for Pricing
View Details