Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAP2 Rabbit Polyclonal Antibody (FITC)

NECAP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ10420, RP4-798A10.1

UniProt

Q9NVZ3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NECAP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060560

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF26B Rabbit pAb, PE-Cy7 conjugated
orb2863492 100 µL

KIF26B Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Rabbit Serum Amyloid A (SAA) CLIA Kit
MBS2708877-01 24 Strip Well

Rabbit Serum Amyloid A (SAA) CLIA Kit

Sign In for Pricing
View Details
Rabbit Serum Amyloid A (SAA) CLIA Kit
MBS2708877-02 48 Well

Rabbit Serum Amyloid A (SAA) CLIA Kit

Sign In for Pricing
View Details
Rabbit Serum Amyloid A (SAA) CLIA Kit
MBS2708877-03 96 Well

Rabbit Serum Amyloid A (SAA) CLIA Kit

Sign In for Pricing
View Details
Rabbit Serum Amyloid A (SAA) CLIA Kit
MBS2708877-04 5x 96 Well

Rabbit Serum Amyloid A (SAA) CLIA Kit

Sign In for Pricing
View Details
Rabbit Serum Amyloid A (SAA) CLIA Kit
MBS2708877-05 10x 96 Well

Rabbit Serum Amyloid A (SAA) CLIA Kit

Sign In for Pricing
View Details