Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Shq1 Rabbit Polyclonal Antibody (HRP)

Shq1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Grim, Grim-1, 2810403P18Rik

UniProt

Q7TMX5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Shq1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PYFLRLTLPGRIVENGSEQGTYDADKGIFTIRLPKETPGQHFEGLNMLTA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_853621

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal RNA Polymerase II/POLR2A Antibody (POLR2A/9089R) [Alexa Fluor 750]
NBP3-24041AF750 0.1 mL

Rabbit Monoclonal RNA Polymerase II/POLR2A Antibody (POLR2A/9089R) [Alexa Fluor 750]

Sign In for Pricing
View Details
Aeromonas hydrophila One-Step PCR kit
Oneq-V240-100D 100 Reactions

Aeromonas hydrophila One-Step PCR kit

Sign In for Pricing
View Details
Dub1 Recombinant Protein (Mouse)
RP130211 100 µg

Dub1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Krt72 3'UTR GFP Stable Cell Line
TU256877 1.0 mL

Krt72 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SR 144528 50mg
A12376-50 50 mg

SR 144528 50mg

Sign In for Pricing
View Details
WASP Rabbit Polyclonal Antibody (AP)
orb930536 100 µL

WASP Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details