Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf104 Rabbit Polyclonal Antibody (Biotin)

C14orf104 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KTU, PF13, CILD10, C14orf104

UniProt

Q9NVR5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf104

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_060609

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)
MBS1183021-01 0.02 mg (E-Coli)

Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)
MBS1183021-02 0.02 mg (Yeast)

Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)
MBS1183021-03 0.1 mg (E-Coli)

Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)
MBS1183021-04 0.1 mg (Yeast)

Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)
MBS1183021-05 0.02 mg (Baculovirus)

Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)

Sign In for Pricing
View Details
Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)
MBS1183021-06 0.02 mg (Mammalian-Cell)

Recombinant Acidovorax sp. tRNA 2-thiocytidine biosynthesis protein TtcA (ttcA)

Sign In for Pricing
View Details