Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP72 Rabbit Polyclonal Antibody (FITC)

CEP72 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIAA1519

UniProt

Q9P209

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CEP72

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSLTGLKSLDLSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHAL

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SLC22A8 Antibody
NBP2-98607-100ul 100 µL

Rabbit Polyclonal SLC22A8 Antibody

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)
MBS1024803-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)
MBS1024803-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)
MBS1024803-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)
MBS1024803-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)
MBS1024803-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Proteasome subunit beta type-1 (PBF1)

Sign In for Pricing
View Details