Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP72 Rabbit Polyclonal Antibody (HRP)

CEP72 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1519

UniProt

Q9P209

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CEP72

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSLTGLKSLDLSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHAL

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PH1-MTFR2-shRNA1-copGFP-Puro Plasmid
PVT75810 2 µg

PH1-MTFR2-shRNA1-copGFP-Puro Plasmid

Sign In for Pricing
View Details
WWC1, NT (WWC1, KIAA0869, Protein KIBRA, HBeAg-binding protein 3, Kidney and brain protein, WW domain-containing protein 1) (MaxLight 650)
MBS6363838-01 0.1 mL

WWC1, NT (WWC1, KIAA0869, Protein KIBRA, HBeAg-binding protein 3, Kidney and brain protein, WW domain-containing protein 1) (MaxLight 650)

Sign In for Pricing
View Details
WWC1, NT (WWC1, KIAA0869, Protein KIBRA, HBeAg-binding protein 3, Kidney and brain protein, WW domain-containing protein 1) (MaxLight 650)
MBS6363838-02 5x 0.1 mL

WWC1, NT (WWC1, KIAA0869, Protein KIBRA, HBeAg-binding protein 3, Kidney and brain protein, WW domain-containing protein 1) (MaxLight 650)

Sign In for Pricing
View Details
Human RUNX3/CBFA3 Recombinant Protein
PROTQ13761-01 10 µg

Human RUNX3/CBFA3 Recombinant Protein

Sign In for Pricing
View Details
Human RUNX3/CBFA3 Recombinant Protein
PROTQ13761-02 50 µg

Human RUNX3/CBFA3 Recombinant Protein

Sign In for Pricing
View Details
Human RUNX3/CBFA3 Recombinant Protein
PROTQ13761-03 100 µg

Human RUNX3/CBFA3 Recombinant Protein

Sign In for Pricing
View Details