Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIC8B Rabbit Polyclonal Antibody (HRP)

RIC8B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RIC8, hSyn

UniProt

A2RTZ0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RIC8B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (AP)
MBS6247561-01 0.1 mL

CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (AP)

Sign In for Pricing
View Details
CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (AP)
MBS6247561-02 5x 0.1 mL

CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (AP)

Sign In for Pricing
View Details
ABIN3 (TNIP3) (NM_001244764) Human Tagged ORF Clone
RG233916 10 µg

ABIN3 (TNIP3) (NM_001244764) Human Tagged ORF Clone

Sign In for Pricing
View Details
6-Amino-4-hydroxy-2-mercaptopyrimidine monohydrate
258341-01 250 g

6-Amino-4-hydroxy-2-mercaptopyrimidine monohydrate

Sign In for Pricing
View Details
6-Amino-4-hydroxy-2-mercaptopyrimidine monohydrate
258341-02 500 g

6-Amino-4-hydroxy-2-mercaptopyrimidine monohydrate

Sign In for Pricing
View Details
6-Amino-4-hydroxy-2-mercaptopyrimidine monohydrate
258341-03 1 Kg

6-Amino-4-hydroxy-2-mercaptopyrimidine monohydrate

Sign In for Pricing
View Details